Skip to content
Closed
Show file tree
Hide file tree
Changes from all commits
Commits
File filter

Filter by extension

Filter by extension

Conversations
Failed to load comments.
Loading
Jump to
Jump to file
Failed to load files.
Loading
Diff view
Diff view
54 changes: 25 additions & 29 deletions advanced/user-auth/oauth.mdx
Original file line number Diff line number Diff line change
@@ -1,41 +1,37 @@
---
title: 'OAuth 2.0'
description: 'Integrate with your OAuth server to enable user login via the PKCE flow'
description: 'Enable user login via OAuth PKCE flow'
---

If you have an existing OAuth server that supports the PKCE flow, you can integrate with Mintlify for a seamless login experience.
Integrate your existing OAuth server with Mintlify to enable user authentication.

## Implementation
## Setup Steps

<Steps>
<Step title="Create your Info API">
Create an API endpoint that can be accessed with an OAuth access token, and responds with a JSON payload following the [UserInfo](./sending-data) format. Take note of the scope or scopes required to access this endpoint.
<Step title="Create Info API">
Create an API endpoint that accepts an OAuth access token and returns user information in the [UserInfo](./sending-data) format.
</Step>
<Step title="Configure your User Auth settings">
Go to your [Mintlify dashboard settings](https://dashboard.mintlify.com/mintlify/mintlify/settings/deployment/user-authentication), select the OAuth option, and fill out the required fields:

- **Authorization URL**: The base URL for the authorization request, to which we will add the appropriate query parameters.
- **Client ID**: An ID for the OAuth 2.0 client to be used.
- **Scopes**: An array of scopes that will be requested.
- **Token URL**: The base URL for the token exchange request.
- **Info API URL**: The endpoint that will be hit to retrieve user info.
<Step title="Configure OAuth Settings">
In your [Mintlify dashboard](https://dashboard.mintlify.com/mintlify/mintlify/settings/deployment/user-authentication), select OAuth and configure:
- Authorization URL
- Client ID
- Required scopes
- Token URL
- Info API URL
</Step>
<Step title="Configure your OAuth client">
Copy the Redirect URL listed in the [Mintlify dashboard settings](https://dashboard.mintlify.com/mintlify/mintlify/settings/deployment/user-authentication) and add it as an authorized redirect URL for your OAuth server.
<Step title="Add Redirect URL">
Add the Redirect URL from your Mintlify dashboard to your OAuth server's authorized redirects.
</Step>
</Steps>

## Example

I have an existing OAuth server that supports the PKCE flow. I want to set up authentication for my docs hosted at `foo.com/docs`.

To set up authentication with Mintlify, I create an endpoint `api.foo.com/docs/user-info` which requires an OAuth access token with the `docs-user-info` scope, and responds with the user's custom data according to Mintlify’s specification.

I then go to the Mintlify dashboard settings, navigate to the User Auth settings, select OAuth, and enter the relevant values for the OAuth flow and Info API endpoint:
- **Authorization URL**: `https://auth.foo.com/authorization`
- **Client ID**: `ydybo4SD8PR73vzWWd6S0ObH`
- **Scopes**: `['docs-user-info']`
- **Token URL**: `https://auth.foo.com/exchange`
- **Info API URL**: `https://api.foo.com/docs/user-info`

Finally, I copy the Redirect URL displayed in the dashboard settings and add it as an authorized redirect URL in my OAuth client configuration settings.
## Example Configuration

```json
{
"authorizationUrl": "https://auth.foo.com/authorization",
"clientId": "ydybo4SD8PR73vzWWd6S0ObH",
"scopes": ["docs-user-info"],
"tokenUrl": "https://auth.foo.com/exchange",
"infoApiUrl": "https://api.foo.com/docs/user-info"
}
```
61 changes: 25 additions & 36 deletions advanced/user-auth/shared-session.mdx
Original file line number Diff line number Diff line change
@@ -1,50 +1,39 @@
---
title: 'Shared Session Auth'
description: 'Seamlessly share user sessions between your dashboard and your docs'
description: 'Share user sessions between your dashboard and docs'
---

This method utilizes the session authentication info already stored in your user’s browser to create a seamless documentation experience.
Share your existing user sessions between your dashboard and documentation for a seamless experience.

## Implementation
## Setup

<Steps>
<Step title="Create your Info API">
Create an API endpoint that uses session authentication to identify users, and responds with a JSON payload following the [UserInfo](./sending-data) format.

If the API domain does not *exactly match* the docs domain:
- Add the docs domain to your API's `Access-Control-Allow-Origin` header (must not be `*`)
- Ensure your API’s `Access-Control-Allow-Credentials` header is `true`
<Warning>
These CORS options only need to be enabled on the *single endpoint* responsible for returning user information. We do not recommend enabling these options on all dashboard endpoints.
</Warning>
<Step title="Create User Info API">
Create an API endpoint that:
- Uses your existing session authentication
- Returns user data in the [UserInfo](./sending-data) format
- Sets proper CORS headers if your API and docs domains differ:
- `Access-Control-Allow-Origin`: Set to your docs domain
- `Access-Control-Allow-Credentials`: Set to `true`
</Step>
<Step title="Configure your User Auth settings">
Go to your [Mintlify dashboard settings](https://dashboard.mintlify.com/mintlify/mintlify/settings/deployment/user-authentication) and add the API URL and your Login URL to your User Auth settings.
<Step title="Configure Settings">
Add your API URL and Login URL in your [Mintlify dashboard settings](https://dashboard.mintlify.com/mintlify/mintlify/settings/deployment/user-authentication).
</Step>
</Steps>

## Examples

### Dashboard at subdomain, docs at subdomain

I have a dashboard at `dash.foo.com`, which uses cookie-based session authentication. My dashboard API routes are hosted at `dash.foo.com/api`. I want to set up authentication for my docs hosted at `docs.foo.com`.

To set up authentication with Mintlify, I create another dashboard endpoint `dash.foo.com/api/docs/user-info` which identifies the user using session auth, and responds with their custom data according to Mintlify’s specification. I then add `https://docs.foo.com` to the `Access-Control-Allow-Origin` allow-list **for this route only**, and ensure my `Access-Control-Allow-Credentials` configuration is set to `true` **for this route only**.

I then go to the Mintlify dashboard settings and enter `https://dash.foo.com/api/docs/user-info` for the API URL field.

### Dashboard at subdomain, docs at root

I have a dashboard at `dash.foo.com`, which uses cookie-based session authentication. My dashboard API routes are hosted at `dash.foo.com/api`. I want to set up authentication for my docs hosted at `foo.com/docs`.

To set up authentication with Mintlify, I create another dashboard endpoint `dash.foo.com/api/docs/user-info` which identifies the user using session auth, and responds with their custom data according to Mintlify’s specification. I then add `https://foo.com` to the `Access-Control-Allow-Origin` allow-list **for this route only**, and ensure my `Access-Control-Allow-Credentials` configuration is set to `true` **for this route only**.

I then go to the Mintlify dashboard settings and enter `https://dash.foo.com/api/docs/user-info` for the API URL field.

### Dashboard at root, docs at root
## Common Setups

I have a dashboard at `foo.com/dashboard`, which uses cookie-based session authentication. My dashboard API routes are hosted at `foo.com/api`. I want to set up authentication for my docs hosted at `foo.com/docs`.
1. **Docs and Dashboard on Subdomains**
- Dashboard: `dash.foo.com`
- Docs: `docs.foo.com`
- API Endpoint: `dash.foo.com/api/docs/user-info`

To set up authentication with Mintlify, I create another dashboard endpoint `foo.com/api/docs/user-info` which identifies the user using session auth, and responds with their custom data according to Mintlify’s specification.
2. **Dashboard on Subdomain, Docs on Root**
- Dashboard: `dash.foo.com`
- Docs: `foo.com/docs`
- API Endpoint: `dash.foo.com/api/docs/user-info`

I then go to the Mintlify dashboard settings and enter `https://foo.com/api/docs/user-info` for the API URL field.
3. **Both on Root Domain**
- Dashboard: `foo.com/dashboard`
- Docs: `foo.com/docs`
- API Endpoint: `foo.com/api/docs/user-info`
92 changes: 14 additions & 78 deletions advanced/widget/chat.mdx
Original file line number Diff line number Diff line change
Expand Up @@ -2,20 +2,16 @@
title: "Chat Widget"
---

Integrate the Mintlify widget into your products to offer users quick access to AI-powered chat with your docs content as the knowledge base.
Add an AI-powered chat widget to your product that lets users search your documentation.

![widget](https://mintlify-assets.b-cdn.net/widget/hero.webp)

## Getting started
## Quick Start

First, generate an API key in [the Mintlify dashboard](https://dashboard.mintlify.com/chat/widget-auth).

![widget](https://mintlify-assets.b-cdn.net/widget/key.webp)

## Installation

Add the widget by adding these script tags into your site's `<head>...<head/>` tag.
1. Get your API key from the [Mintlify dashboard](https://dashboard.mintlify.com/chat/widget-auth)
2. Add the widget to your site:

### HTML Installation
```html
<script>
window.mintlifyWidgetSettings = {
Expand All @@ -37,8 +33,7 @@ Add the widget by adding these script tags into your site's `<head>...<head/>` t
</script>
```

To use the widget in React and Next.js apps, use the React component from the `@mintlify/widget-react` [package](https://www.npmjs.com/package/@mintlify/widget-react). Here is a basic example of how to use the component in your React application:

### React Installation
```jsx
<MintlifyWidget
connection={{
Expand All @@ -47,73 +42,14 @@ To use the widget in React and Next.js apps, use the React component from the `@
/>
```

## Usage

In the first script tag or the React component props, you can customize the appearance and other settings of the widget. `mintlifyWidgetSettings` accepts the following props:

| Prop | Type | Description |
| ------------ | ------------------------------------------------------------------- | ---------------------------------------------------------- |
| `connection` | [MintlifyWidgetConnectionProps](#mintlifywidgetconnectionProps) | Information needed to connect to our API. Required. |
| `display?` | [MintlifyWidgetDisplayProps](#mintlifywidgetdisplayProps) | Configurations for the widget appearance and interactions. |
| `tracking?` | [MintlifyWidgetTrackingFunctions](#mintlifywidgettrackingfunctions) | Callback functions for tracking analytics. |

### MintlifyWidgetConnectionProps

| Prop | Type | Description |
| -------- | -------- | ----------------------------------------------------------- |
| `apiKey` | `string` | Widget API key generated from Mintlify dashboard. Required. |
| `url?` | `string` | Used for internal testing only |

### MintlifyWidgetDisplayProps

| Prop | Type | Description |
| ------------- | ----------------------------------------------------------------------- | ----------------------------------------------------------- |
| `trigger?` | [MintlifyWidgetDisplayTriggerProps](#mintlifywidgetdisplaytriggerprops) | Appearance of the trigger. |
| `colors?` | [MintlifyWidgetDisplayColorsProps](#mintlifywidgetdisplaycolorsprops) | Colors used across the widget. |
| `chat?` | [MintlifyWidgetDisplayChatProps](#mintlifywidgetdisplaychatprops) | Configs specific to AI chat. |
| `isDarkMode?` | `boolean` | Controlled dark mode appearance. Defaults to OS preference. |

#### MintlifyWidgetDisplayTriggerProps

| Prop | Type | Description |
| ------------- | ------------------------------------ | -------------------------------------------------------------------------------------------------------------------------- |
| `type?` | `'button'`\|`'input'` | Type of the trigger to display. Defaults to `button`. |
| `label?` | `string` | Label displayed in the trigger. Defaults to `Get help` for the button trigger and `Ask anything...` for the input trigger. |
| `buttonIcon?` | `'chat'`\|`'sparkles'`\|`'mintlify'` | Icon used in the trigger. Only available for the `button` trigger. Defaults to `chat`. |
| `iconOnly?` | `boolean` | Only show icon in the trigger or not. Defaults to `false`. |

Here is an overview of what the trigger looks like with different configurations.

| `type='input'` | |
| -------------- | ------------------------------------------------------------ |
| | <img style={{height:'80px'}} src="https://mintlify-assets.b-cdn.net/widget/input.png"/> |

| `type='button'` | `'chat'` | `'sparkles'` | `'mintlify'` |
| ---------------- | --------------------------------------------------------------------------- | ------------------------------------------------------------------------------- | ------------------------------------------------------------------------------- |
| `iconOnly=false` | <img style={{height:'80px'}} src="https://mintlify-assets.b-cdn.net/widget/button-chat.png"/> | <img style={{height:'80px'}} src="https://mintlify-assets.b-cdn.net/widget/button-sparkles.png"/> | <img style={{height:'80px'}} src="https://mintlify-assets.b-cdn.net/widget/button-mintlify.png"/> |
| `iconOnly=true` | <img style={{height:'80px'}} src="https://mintlify-assets.b-cdn.net/widget/button-chat-iconOnly.png"/> | <img style={{height:'80px'}} src="https://mintlify-assets.b-cdn.net/widget/button-sparkles-iconOnly.png"/> | <img style={{height:'80px'}} src="https://mintlify-assets.b-cdn.net/widget/button-mintlify-iconOnly.png"/> |

#### MintlifyWidgetDisplayColorsProps

| Prop | Type | Description |
| --------------- | -------- | -------------------------------------------------------- |
| `primary?` | `string` | Primary color used in the widget. Defaults to `#0D9373`. |
| `primaryLight?` | `string` | Primary color in dark mode. Defaults to `#55D799`. |

#### MintlifyWidgetDisplayChatProps
## Customization

| Prop | Type | Description |
| ------------------------ | ---------- | ------------------------------------------------------------------ |
| `openCitationInSameTab?` | `boolean` | Open the citation url in the same tab or not. Defaults to `false`. |
| `exampleQueries?` | `string[]` | Example queries to prompt the user to ask. Defaults to `[]`. |
The widget can be customized using these main properties:

### MintlifyWidgetTrackingFunctions
| Property | Description |
|------------|-----------------------------------------------------|
| `connection` | Required. Contains your API key |
| `display` | Optional. Customize appearance and interactions |
| `tracking` | Optional. Add analytics tracking |

| Prop | Type | Description |
| --------------------- | ------------------------------------------ | -------------------------------------------------- |
| `trackChatEnter` | `()=> void` | Triggered when the user opens the chat widget. |
| `trackCitationClick` | `(title: string, url: string)=> void` | Triggered when the user clicks on a citation. |
| `trackChatThumbsUp` | `(query: string, response: string)=> void` | Triggered when the user thumbs up on a response. |
| `trackChatThumbsDown` | `(query: string, response: string)=> void` | Triggered when the user thumbs down on a response. |
| `trackChatFollowup` | `(query: string)=> void` | Triggered when the user asks a question. |
| `trackChatClose` | `(queriesCount: number)=> void` | Triggered when the user exits the chat widget. |
[View detailed configuration options →](https://mintlify.com/docs/widget/configuration)
39 changes: 14 additions & 25 deletions api-playground/mdx/configuration.mdx
Original file line number Diff line number Diff line change
Expand Up @@ -3,25 +3,24 @@ title: 'MDX Setup'
description: 'Generate docs pages for your API endpoints using MDX'
---

Mintlify allows you to define your API endpoints using a combination of `mint.json` configuration, MDX metadata fields, and the `<ParamFields />` component. From the defined endpoints, we generate an API playground, request examples, and response examples.
Mintlify helps you create interactive API documentation using MDX. Here's how to get started:

<Steps>
<Step title="Configure your API">
In your `mint.json` file, define your base URL and auth method:
<Step title="Configure API in mint.json">
Add your API configuration to `mint.json`:

```json
{
"api": {
"baseUrl": "https://mintlify.com/api", // string array for multiple base URLs
"baseUrl": "https://mintlify.com/api",
"auth": {
"method": "bearer" // options: bearer, basic, key.
"method": "bearer"
}
}
}
```

If you would not like to show an API playground, you don't need to include auth types. Hide the playground with the following field:

To hide the API playground, use:
```json
{
"api": {
Expand All @@ -31,35 +30,25 @@ Mintlify allows you to define your API endpoints using a combination of `mint.js
}
}
```

Find a full list of API configurations [here](/settings/global#api-configurations).
</Step>

<Step title="Create your endpoint pages">

Each API endpoint page should have a corresponding MDX file. At the top of each file, define:
<Step title="Create endpoint pages">
Create MDX files for each endpoint with the required metadata:

```md
---
title: 'Create new user'
api: 'POST https://api.mintlify.com/user'
api: 'POST /user'
---
```

You can specify path parameters by adding the parameter name to the path, wrapped with `{}`:

For paths with parameters, use `{paramName}` syntax:
```bash
https://api.example.com/v1/endpoint/{userId}
/v1/endpoint/{userId}
```

<Note>

If you have `baseUrl` configured in [mint.json](/settings/global), you can use relative paths like `/v1/endpoint`.

</Note>
</Step>

<Step title="Add your endpoints to your docs">
Add your endpoint pages to the sidebar by adding the paths to the `navigation` field in your `mint.json`. Learn more about structuring your docs [here](/settings/navigation).
<Step title="Add to navigation">
Add your endpoint pages to the `navigation` field in `mint.json` to display them in your sidebar.
</Step>
</Steps>
</Steps>
Loading
Loading