Skip to content
Draft
Show file tree
Hide file tree
Changes from all commits
Commits
File filter

Filter by extension

Filter by extension

Conversations
Failed to load comments.
Loading
Jump to
Jump to file
Failed to load files.
Loading
Diff view
Diff view
3,467 changes: 3,387 additions & 80 deletions docs/examples/2_query_filter_index.ipynb

Large diffs are not rendered by default.

233 changes: 218 additions & 15 deletions docs/examples/3_access_system_files.ipynb
Original file line number Diff line number Diff line change
Expand Up @@ -16,7 +16,7 @@
},
{
"cell_type": "code",
"execution_count": null,
"execution_count": 1,
"metadata": {},
"outputs": [],
"source": [
Expand All @@ -36,9 +36,28 @@
},
{
"cell_type": "code",
"execution_count": null,
"execution_count": 2,
"metadata": {},
"outputs": [],
"outputs": [
{
"name": "stderr",
"output_type": "stream",
"text": [
"2024-11-27 10:18:44,563 | plinder.core.utils.cpl.download_paths:24 | INFO : runtime succeeded: 0.00s\n",
"2024-11-27 10:18:44,563 | plinder.core.utils.cpl.download_paths:24 | INFO : runtime succeeded: 0.00s\n"
]
},
{
"data": {
"text/plain": [
"{'1.W': '/Users/yusuf/.local/share/plinder/2024-06/v2/systems/4agi__1__1.C__1.W/ligand_files/1.W.sdf'}"
]
},
"execution_count": 2,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
"plinder_system.ligand_sdfs"
]
Expand All @@ -52,9 +71,31 @@
},
{
"cell_type": "code",
"execution_count": null,
"execution_count": 3,
"metadata": {},
"outputs": [],
"outputs": [
{
"name": "stderr",
"output_type": "stream",
"text": [
"2024-11-27 10:18:44,693 | plinder.core.utils.cpl.download_paths:24 | INFO : runtime succeeded: 0.00s\n",
"2024-11-27 10:18:44,693 | plinder.core.utils.cpl.download_paths:24 | INFO : runtime succeeded: 0.00s\n",
"2024-11-27 10:18:44,694 | plinder.core.index.utils:148 | INFO : loading entries from 1 zips\n",
"2024-11-27 10:18:44,700 | plinder.core.index.utils:163 | INFO : loaded 1 entries\n",
"2024-11-27 10:18:44,700 | plinder.core.index.utils.load_entries:24 | INFO : runtime succeeded: 0.11s\n"
]
},
{
"data": {
"text/plain": [
"{'1.W': 'C[Se][C@@H]1O[C@@H](C)[C@@H](O)[C@@H](O)[C@@H]1O'}"
]
},
"execution_count": 3,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
"plinder_system.smiles"
]
Expand All @@ -75,9 +116,21 @@
},
{
"cell_type": "code",
"execution_count": null,
"execution_count": 4,
"metadata": {},
"outputs": [],
"outputs": [
{
"data": {
"text/plain": [
"('/Users/yusuf/.local/share/plinder/2024-06/v2/systems/4agi__1__1.C__1.W/receptor.pdb',\n",
" '/Users/yusuf/.local/share/plinder/2024-06/v2/systems/4agi__1__1.C__1.W/receptor.cif')"
]
},
"execution_count": 4,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
"plinder_system.receptor_pdb, plinder_system.receptor_cif"
]
Expand All @@ -91,9 +144,20 @@
},
{
"cell_type": "code",
"execution_count": null,
"execution_count": 5,
"metadata": {},
"outputs": [],
"outputs": [
{
"data": {
"text/plain": [
"{'1.C': 'A'}"
]
},
"execution_count": 5,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
"plinder_system.chain_mapping"
]
Expand All @@ -107,9 +171,21 @@
},
{
"cell_type": "code",
"execution_count": null,
"execution_count": 6,
"metadata": {},
"outputs": [],
"outputs": [
{
"data": {
"text/plain": [
"('/Users/yusuf/.local/share/plinder/2024-06/v2/systems/4agi__1__1.C__1.W/sequences.fasta',\n",
" {'1.C': 'MSTPGAQQVLFRTGIAAVNSTNHLRVYFQDVYGSIRESLYEGSWANGTEKNVIGNAKLGSPVAATSKELKHIRVYTLTEGNTLQEFAYDSGTGWYNGGLGGAKFQVAPYSXIAAVFLAGTDALQLRIYAQKPDNTIQEYMWNGDGWKEGTNLGGALPGTGIGATSFRYTDYNGPSIRIWFQTDDLKLVQRAYDPHKGWYPDLVTIFDRAPPRTAIAATSFGAGNSSIYMRIYFVNSDNTIWQVCWDHGKGYHDKGTITPVIQGSEVAIISWGSFANNGPDLRLYFQNGTYISAVSEWVWNRAHGSQLGRSALPPA'})"
]
},
"execution_count": 6,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
"plinder_system.sequences_fasta, plinder_system.sequences"
]
Expand All @@ -127,18 +203,145 @@
},
{
"cell_type": "code",
"execution_count": null,
"execution_count": 7,
"metadata": {},
"outputs": [],
"outputs": [
{
"name": "stderr",
"output_type": "stream",
"text": [
"2024-11-27 10:18:45,149 | plinder.core.utils.cpl.download_paths:24 | INFO : runtime succeeded: 0.17s\n",
"2024-11-27 10:18:45,546 | plinder.core.scores.links.query_links:24 | INFO : runtime succeeded: 0.72s\n"
]
}
],
"source": [
"link_info = plinder_system.linked_structures"
]
},
{
"cell_type": "code",
"execution_count": null,
"execution_count": 8,
"metadata": {},
"outputs": [],
"outputs": [
{
"data": {
"text/html": [
"<div>\n",
"<style scoped>\n",
" .dataframe tbody tr th:only-of-type {\n",
" vertical-align: middle;\n",
" }\n",
"\n",
" .dataframe tbody tr th {\n",
" vertical-align: top;\n",
" }\n",
"\n",
" .dataframe thead th {\n",
" text-align: right;\n",
" }\n",
"</style>\n",
"<table border=\"1\" class=\"dataframe\">\n",
" <thead>\n",
" <tr style=\"text-align: right;\">\n",
" <th></th>\n",
" <th>id</th>\n",
" <th>pocket_fident</th>\n",
" <th>lddt</th>\n",
" <th>bb_lddt</th>\n",
" <th>lddt_lp_ave</th>\n",
" <th>lddt_pli_ave</th>\n",
" <th>bisy_rmsd_ave</th>\n",
" <th>sort_score</th>\n",
" <th>kind</th>\n",
" </tr>\n",
" </thead>\n",
" <tbody>\n",
" <tr>\n",
" <th>0</th>\n",
" <td>4uou_B</td>\n",
" <td>100.0</td>\n",
" <td>0.972682</td>\n",
" <td>0.994065</td>\n",
" <td>0.987813</td>\n",
" <td>0.989777</td>\n",
" <td>0.159702</td>\n",
" <td>2.40</td>\n",
" <td>apo</td>\n",
" </tr>\n",
" <tr>\n",
" <th>1</th>\n",
" <td>4uou_C</td>\n",
" <td>100.0</td>\n",
" <td>0.973562</td>\n",
" <td>0.994687</td>\n",
" <td>0.967287</td>\n",
" <td>0.951068</td>\n",
" <td>0.194233</td>\n",
" <td>2.40</td>\n",
" <td>apo</td>\n",
" </tr>\n",
" <tr>\n",
" <th>2</th>\n",
" <td>4uou_D</td>\n",
" <td>100.0</td>\n",
" <td>0.973604</td>\n",
" <td>0.994235</td>\n",
" <td>0.972579</td>\n",
" <td>0.973048</td>\n",
" <td>0.101252</td>\n",
" <td>2.40</td>\n",
" <td>apo</td>\n",
" </tr>\n",
" <tr>\n",
" <th>3</th>\n",
" <td>4uou_A</td>\n",
" <td>100.0</td>\n",
" <td>0.967257</td>\n",
" <td>0.994800</td>\n",
" <td>0.976908</td>\n",
" <td>0.963504</td>\n",
" <td>0.214243</td>\n",
" <td>2.40</td>\n",
" <td>apo</td>\n",
" </tr>\n",
" <tr>\n",
" <th>4</th>\n",
" <td>Q4WW81_A</td>\n",
" <td>100.0</td>\n",
" <td>0.982275</td>\n",
" <td>0.998587</td>\n",
" <td>0.999679</td>\n",
" <td>0.997273</td>\n",
" <td>0.126228</td>\n",
" <td>98.57</td>\n",
" <td>pred</td>\n",
" </tr>\n",
" </tbody>\n",
"</table>\n",
"</div>"
],
"text/plain": [
" id pocket_fident lddt bb_lddt lddt_lp_ave lddt_pli_ave \\\n",
"0 4uou_B 100.0 0.972682 0.994065 0.987813 0.989777 \n",
"1 4uou_C 100.0 0.973562 0.994687 0.967287 0.951068 \n",
"2 4uou_D 100.0 0.973604 0.994235 0.972579 0.973048 \n",
"3 4uou_A 100.0 0.967257 0.994800 0.976908 0.963504 \n",
"4 Q4WW81_A 100.0 0.982275 0.998587 0.999679 0.997273 \n",
"\n",
" bisy_rmsd_ave sort_score kind \n",
"0 0.159702 2.40 apo \n",
"1 0.194233 2.40 apo \n",
"2 0.101252 2.40 apo \n",
"3 0.214243 2.40 apo \n",
"4 0.126228 98.57 pred "
]
},
"execution_count": 8,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
"link_info[\n",
" [\n",
Expand Down
Loading